SCOPe 2.07: Domain d5gzzb2: 5gzz B:81-216

Lineage for d5gzzb2 (5gzz B:81-216)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
   Uniprot P08515

8. Domain d5gzzb2: 5gzz B:81-216 [329850]
   Other proteins in same PDB: d5gzzb1, d5gzzc1, d5gzzd1, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg1
   automated match to d1m9aa1
   complexed with gsh, jaa

Details for d5gzzb2

PDB Entry: 5gzz, 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja

PDB Compounds: (B:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzb2:

Sequence; same for both SEQRES and ATOM records:

>d5gzzb2 a.45.1.1 (B:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d5gzzb2:

• d5gzzb2 first appeared in SCOPe 2.06
  
• d5gzzb2 appears in the current release, SCOPe 2.08