Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5u72e1: 5u72 E:2-116 [329661] Other proteins in same PDB: d5u72a1, d5u72a3, d5u72b2, d5u72c1, d5u72c3, d5u72d2, d5u72f_, d5u72h_ automated match to d2axha1 complexed with 7zv, act, dms, gol |
PDB Entry: 5u72 (more details), 2.5 Å
SCOPe Domain Sequences for d5u72e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u72e1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle
Timeline for d5u72e1: