Lineage for d5u72e1 (5u72 E:2-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033683Domain d5u72e1: 5u72 E:2-116 [329661]
    Other proteins in same PDB: d5u72a1, d5u72a3, d5u72b2, d5u72c1, d5u72c3, d5u72d2, d5u72f_, d5u72h_
    automated match to d2axha1
    complexed with 7zv, act, dms, gol

Details for d5u72e1

PDB Entry: 5u72 (more details), 2.5 Å

PDB Description: structure of human mr1-5oh-dcf in complex with human mait a-f7 tcr
PDB Compounds: (E:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u72e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u72e1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

SCOPe Domain Coordinates for d5u72e1:

Click to download the PDB-style file with coordinates for d5u72e1.
(The format of our PDB-style files is described here.)

Timeline for d5u72e1: