Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5u2vc2: 5u2v C:179-269 [329632] Other proteins in same PDB: d5u2va1, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc3, d5u2vd_, d5u2ve2, d5u2vg2 automated match to d4l4va2 complexed with 7wq, gol, pro |
PDB Entry: 5u2v (more details), 2.2 Å
SCOPe Domain Sequences for d5u2vc2:
Sequence, based on SEQRES records: (download)
>d5u2vc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d5u2vc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnralfckahgfyppeiymtwmkngeeivqeidygdilpsgdgtyqawasiel dpqssnlyschvehsgvhmvlqv
Timeline for d5u2vc2: