Lineage for d5u2vf2 (5u2v F:117-244)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367507Domain d5u2vf2: 5u2v F:117-244 [329605]
    Other proteins in same PDB: d5u2va1, d5u2va3, d5u2vb_, d5u2vc1, d5u2vc3, d5u2vd_, d5u2ve2, d5u2vg2
    automated match to d2vlme2
    complexed with 7wq, gol, pro

Details for d5u2vf2

PDB Entry: 5u2v (more details), 2.2 Å

PDB Description: structure of human mr1-hmb in complex with human mait a-f7 tcr
PDB Compounds: (F:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u2vf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2vf2 b.1.1.0 (F:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d5u2vf2:

Click to download the PDB-style file with coordinates for d5u2vf2.
(The format of our PDB-style files is described here.)

Timeline for d5u2vf2: