Lineage for d5u08b_ (5u08 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969510Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)
  8. 2969514Domain d5u08b_: 5u08 B: [329578]
    automated match to d5hmnc_
    complexed with act, ca, mg, sis

Details for d5u08b_

PDB Entry: 5u08 (more details), 1.52 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with sisomicin
PDB Compounds: (B:) aminoglycoside acetyltransferase meta-AAC0020

SCOPe Domain Sequences for d5u08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u08b_ d.108.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
dkvddyaldfarstkptaeeqvvhfyytlk

SCOPe Domain Coordinates for d5u08b_:

Click to download the PDB-style file with coordinates for d5u08b_.
(The format of our PDB-style files is described here.)

Timeline for d5u08b_: