SCOPe 2.02: Domain d3gsta2: 3gst A:1-84

Lineage for d3gsta2 (3gst A:1-84)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)

8. Domain d3gsta2: 3gst A:1-84 [32931]
   Other proteins in same PDB: d3gsta1, d3gstb1
   complexed with gpr, so4

Details for d3gsta2

PDB Entry: 3gst, 1.9 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3gsta2:

Sequence; same for both SEQRES and ATOM records:

>d3gsta2 c.47.1.5 (A:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d3gsta2:

• d3gsta2 first appeared (with stable ids) in SCOP 1.55
  
• d3gsta2 appears in SCOPe 2.01
  
• d3gsta2 appears in SCOPe 2.03
  
• d3gsta2 appears in the current release, SCOPe 2.08