Lineage for d4gtue2 (4gtu E:1-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699397Protein Class mu GST [81359] (3 species)
  7. 699405Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
  8. 699455Domain d4gtue2: 4gtu E:1-84 [32919]
    Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtue2

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4
PDB Compounds: (E:) glutathione s-transferase

SCOP Domain Sequences for d4gtue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtue2 c.47.1.5 (E:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d4gtue2:

Click to download the PDB-style file with coordinates for d4gtue2.
(The format of our PDB-style files is described here.)

Timeline for d4gtue2: