![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
![]() | Protein Class mu GST [81348] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries) |
![]() | Domain d4gtuh1: 4gtu H:85-217 [17628] Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2 |
PDB Entry: 4gtu (more details), 3.3 Å
SCOP Domain Sequences for d4gtuh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtuh1 a.45.1.1 (H:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp kplytrvavwgnk
Timeline for d4gtuh1: