SCOPe 2.07: Domain d5ui2a1: 5ui2 A:2-175

Lineage for d5ui2a1 (5ui2 A:2-175)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
   multihelical; array

4. Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families)
   duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
   automatically mapped to Pfam PF09150

5. Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)

6. Protein Orange carotenoid protein, N-terminal domain [81932] (1 species)

7. Species Arthrospira maxima [TaxId:129910] [81933] (1 PDB entry)

8. Domain d5ui2a1: 5ui2 A:2-175 [329075]
   Other proteins in same PDB: d5ui2a2, d5ui2b2
   automated match to d1m98a1
   complexed with cl, eq3, suc

Details for d5ui2a1

PDB Entry: 5ui2, 2.1 Å

PDB Description: crystal structure of orange carotenoid protein

PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5ui2a1:

Sequence; same for both SEQRES and ATOM records:

>d5ui2a1 a.175.1.1 (A:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]}
pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva

Timeline for d5ui2a1:

• d5ui2a1 first appeared in SCOPe 2.06
  
• d5ui2a1 appears in the current release, SCOPe 2.08