![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
![]() | Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) ![]() duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
![]() | Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) |
![]() | Protein Orange carotenoid protein, N-terminal domain [81932] (1 species) |
![]() | Species Arthrospira maxima [TaxId:129910] [81933] (1 PDB entry) |
![]() | Domain d5ui2b1: 5ui2 B:2-175 [329078] Other proteins in same PDB: d5ui2a2, d5ui2b2 automated match to d1m98a1 complexed with cl, eq3, suc |
PDB Entry: 5ui2 (more details), 2.1 Å
SCOPe Domain Sequences for d5ui2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ui2b1 a.175.1.1 (B:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]} pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva
Timeline for d5ui2b1: