| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries) |
| Domain d1gtif2: 1gti F:1-78 [32897] Other proteins in same PDB: d1gtia1, d1gtib1, d1gtic1, d1gtid1, d1gtie1, d1gtif1 complexed with gtb |
PDB Entry: 1gti (more details), 3 Å
SCOPe Domain Sequences for d1gtif2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtif2 c.47.1.5 (F:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl
Timeline for d1gtif2: