SCOP 1.75: Domain d1gtif2: 1gti F:1-78

Lineage for d1gtif2 (1gti F:1-78)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)

8. Domain d1gtif2: 1gti F:1-78 [32897]
   Other proteins in same PDB: d1gtia1, d1gtib1, d1gtic1, d1gtid1, d1gtie1, d1gtif1
   complexed with cay, gtb

Details for d1gtif2

PDB Entry: 1gti, 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione

PDB Compounds: (F:) glutathione s-transferase

SCOP Domain Sequences for d1gtif2:

Sequence; same for both SEQRES and ATOM records:

>d1gtif2 c.47.1.5 (F:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d1gtif2:

• d1gtif2 first appeared (with stable ids) in SCOP 1.55
  
• d1gtif2 appears in SCOP 1.73
  
• d1gtif2 appears in SCOPe 2.01
  
• d1gtif2 appears in the current release, SCOPe 2.08