| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries) |
| Domain d2glra2: 2glr A:1-78 [32888] Other proteins in same PDB: d2glra1, d2glrb1 |
PDB Entry: 2glr (more details), 2.2 Å
SCOP Domain Sequences for d2glra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glra2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl
Timeline for d2glra2: