Lineage for d2glra2 (2glr A:1-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876959Protein Class pi GST [81358] (4 species)
  7. 2877103Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
  8. 2877114Domain d2glra2: 2glr A:1-78 [32888]
    Other proteins in same PDB: d2glra1, d2glrb1
    complexed with gtx

Details for d2glra2

PDB Entry: 2glr (more details), 2.2 Å

PDB Description: molecular structure at 1.8 angstroms of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
PDB Compounds: (A:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d2glra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glra2 c.47.1.5 (A:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d2glra2:

Click to download the PDB-style file with coordinates for d2glra2.
(The format of our PDB-style files is described here.)

Timeline for d2glra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2glra1