Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
Protein automated matches [233857] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
Domain d5ffga2: 5ffg A:440-594 [328820] Other proteins in same PDB: d5ffga1 automated match to d1m1xa1 complexed with bma, ca, man, mes, nag, peg, so4 |
PDB Entry: 5ffg (more details), 2.25 Å
SCOPe Domain Sequences for d5ffga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ffga2 b.1.15.0 (A:440-594) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahil
Timeline for d5ffga2: