SCOPe 2.08: Domain d5ffga2: 5ffg A:440-594

Lineage for d5ffga2 (5ffg A:440-594)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)

8. Domain d5ffga2: 5ffg A:440-594 [328820]
   Other proteins in same PDB: d5ffga1
   automated match to d1m1xa1
   complexed with ca, mes, nag, peg, so4

Details for d5ffga2

PDB Entry: 5ffg, 2.25 Å

PDB Description: crystal structure of integrin alpha v beta 6 head

PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5ffga2:

Sequence; same for both SEQRES and ATOM records:

>d5ffga2 b.1.15.0 (A:440-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahil

Timeline for d5ffga2:

• d5ffga2 first appeared in SCOPe 2.06
  
• d5ffga2 appears in SCOPe 2.07