Lineage for d5t6ua_ (5t6u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2533784Protein (Pro)cathepsin K [54028] (3 species)
  7. 2533852Species Mouse (Mus musculus) [TaxId:10090] [328741] (2 PDB entries)
  8. 2533853Domain d5t6ua_: 5t6u A: [328742]
    automated match to d2f7da1
    complexed with nag, so4

Details for d5t6ua_

PDB Entry: 5t6u (more details), 2.9 Å

PDB Description: crystal structure of mouse cathepsin k at 2.9 angstroms resolution.
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d5t6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6ua_ d.3.1.1 (A:) (Pro)cathepsin K {Mouse (Mus musculus) [TaxId: 10090]}
vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten
ygcgggymttafqyvqqnggidsedaypyvgqdescmynatakaakcrgyreipvgneka
lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii
knswgeswgnkgyallarnknnacgitnmasfpkm

SCOPe Domain Coordinates for d5t6ua_:

Click to download the PDB-style file with coordinates for d5t6ua_.
(The format of our PDB-style files is described here.)

Timeline for d5t6ua_: