Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin K [54028] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [328741] (2 PDB entries) |
Domain d5t6ua_: 5t6u A: [328742] automated match to d2f7da1 complexed with nag, so4 |
PDB Entry: 5t6u (more details), 2.9 Å
SCOPe Domain Sequences for d5t6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t6ua_ d.3.1.1 (A:) (Pro)cathepsin K {Mouse (Mus musculus) [TaxId: 10090]} vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten ygcgggymttafqyvqqnggidsedaypyvgqdescmynatakaakcrgyreipvgneka lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii knswgeswgnkgyallarnknnacgitnmasfpkm
Timeline for d5t6ua_: