SCOPe 2.02: Domain d1eohc2: 1eoh C:1-76

Lineage for d1eohc2 (1eoh C:1-76)

Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class pi GST [81358] (4 species)
Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
Domain d1eohc2: 1eoh C:1-76 [32870]
Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eohc2

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1eohc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohc2 c.47.1.5 (C:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d1eohc2:

Click to download the PDB-style file with coordinates for d1eohc2.
(The format of our PDB-style files is described here.)

Timeline for d1eohc2: