![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
![]() | Domain d5hjye1: 5hjy E:1-138 [328542] Other proteins in same PDB: d5hjya2, d5hjyb2, d5hjyc2, d5hjyd2, d5hjye2, d5hjyf2 automated match to d4lf2a1 complexed with cap, cl, mg; mutant |
PDB Entry: 5hjy (more details), 2.3 Å
SCOPe Domain Sequences for d5hjye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjye1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hjye1: