PDB entry 5hjy

View 5hjy on RCSB PDB site
Description: Structure function studies of R. palustris RubisCO (I165T mutant; CABP-bound)
Class: lyase
Keywords: RubisCO, hexamer, LYASE
Deposited on 2016-01-13, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjya1, d5hjya2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjyb1, d5hjyb2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjyc1, d5hjyc2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjyd1, d5hjyd2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjye1, d5hjye2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d5hjyf1, d5hjyf2
  • Heterogens: CAP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hjyA (A:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyA (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hjyB (B:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyB (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hjyC (C:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyC (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hjyD (D:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyD (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hjyE (E:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyE (E:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hjyF (F:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgttikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hjyF (F:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgttikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak