Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [328462] (1 PDB entry) |
Domain d5h9ub1: 5h9u B:1-118 [328513] automated match to d4odja1 |
PDB Entry: 5h9u (more details), 2.67 Å
SCOPe Domain Sequences for d5h9ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h9ub1 d.130.1.0 (B:1-118) automated matches {Thermus thermophilus [TaxId: 262724]} mralrlvtsesvteghpdkladrisdaildaliaqdkkarvaaetlvttglvfvageitt egyvdipnlvrktvrevgytrakygfdadtcavltaideqspdiaggvnlsyewrvlk
Timeline for d5h9ub1: