Lineage for d5h9ub1 (5h9u B:1-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976729Species Thermus thermophilus [TaxId:262724] [328462] (1 PDB entry)
  8. 2976733Domain d5h9ub1: 5h9u B:1-118 [328513]
    automated match to d4odja1

Details for d5h9ub1

PDB Entry: 5h9u (more details), 2.67 Å

PDB Description: crystal structure of a thermostable methionine adenosyltransferase
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5h9ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9ub1 d.130.1.0 (B:1-118) automated matches {Thermus thermophilus [TaxId: 262724]}
mralrlvtsesvteghpdkladrisdaildaliaqdkkarvaaetlvttglvfvageitt
egyvdipnlvrktvrevgytrakygfdadtcavltaideqspdiaggvnlsyewrvlk

SCOPe Domain Coordinates for d5h9ub1:

Click to download the PDB-style file with coordinates for d5h9ub1.
(The format of our PDB-style files is described here.)

Timeline for d5h9ub1: