SCOPe 2.02: Domain d5gssb2: 5gss B:2-76

Lineage for d5gssb2 (5gss B:2-76)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)

8. Domain d5gssb2: 5gss B:2-76 [32847]
   Other proteins in same PDB: d5gssa1, d5gssb1
   complexed with gsh, mes

Details for d5gssb2

PDB Entry: 5gss, 1.95 Å

PDB Description: human glutathione s-transferase p1-1, complex with glutathione

PDB Compounds: (B:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d5gssb2:

Sequence; same for both SEQRES and ATOM records:

>d5gssb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d5gssb2:

• d5gssb2 first appeared (with stable ids) in SCOP 1.55
  
• d5gssb2 appears in SCOPe 2.01
  
• d5gssb2 appears in SCOPe 2.03
  
• d5gssb2 appears in the current release, SCOPe 2.08