| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries) |
| Domain d3pgta2: 3pgt A:0-76 [32844] Other proteins in same PDB: d3pgta1, d3pgtb1 complexed with gbx, mes, so4 |
PDB Entry: 3pgt (more details), 2.14 Å
SCOPe Domain Sequences for d3pgta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pgta2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl
Timeline for d3pgta2: