| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries) |
| Domain d13gsa2: 13gs A:0-76 [32824] Other proteins in same PDB: d13gsa1, d13gsb1 complexed with gsh, mes, sas |
PDB Entry: 13gs (more details), 1.9 Å
SCOPe Domain Sequences for d13gsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d13gsa2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl
Timeline for d13gsa2: