Lineage for d18gsa2 (18gs A:2-76)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168697Protein Class pi GST [81358] (4 species)
  7. 1168698Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 1168719Domain d18gsa2: 18gs A:2-76 [32822]
    Other proteins in same PDB: d18gsa1, d18gsb1
    complexed with gdn, mes

Details for d18gsa2

PDB Entry: 18gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1 complexed with 1-(s-glutathionyl)-2,4-dinitrobenzene
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d18gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d18gsa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d18gsa2:

Click to download the PDB-style file with coordinates for d18gsa2.
(The format of our PDB-style files is described here.)

Timeline for d18gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d18gsa1