Lineage for d5ku9a_ (5ku9 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021303Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)
  7. 3021458Species Mouse (Mus musculus) [TaxId:10090] [118213] (6 PDB entries)
    Uniprot P97287 152-308
  8. 3021459Domain d5ku9a_: 5ku9 A: [328046]
    automated match to d2kbwa_
    complexed with 6xj, na

Details for d5ku9a_

PDB Entry: 5ku9 (more details), 2.2 Å

PDB Description: crystal structure of mcl1 with compound 1
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5ku9a_:

Sequence, based on SEQRES records: (download)

>d5ku9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records): (download)

>d5ku9a_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
ddlyrqsleiisrylreqatgskkplgeagaagrraletlrrvgdgvqrnhetafqgmlr
kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes
itdvlvrtkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d5ku9a_:

Click to download the PDB-style file with coordinates for d5ku9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ku9a_: