Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.3: Calsequestrin [52855] (1 protein) |
Protein Calsequestrin [52856] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry) |
Domain d1a8y_1: 1a8y 3-126 [32781] |
PDB Entry: 1a8y (more details), 2.4 Å
SCOP Domain Sequences for d1a8y_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8y_1 c.47.1.3 (3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus)} gldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilelaa qvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflldv ledp
Timeline for d1a8y_1: