Lineage for d1a8y_1 (1a8y 3-126)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70895Family c.47.1.3: Calsequestrin [52855] (1 protein)
  6. 70896Protein Calsequestrin [52856] (1 species)
  7. 70897Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry)
  8. 70898Domain d1a8y_1: 1a8y 3-126 [32781]

Details for d1a8y_1

PDB Entry: 1a8y (more details), 2.4 Å

PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution

SCOP Domain Sequences for d1a8y_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8y_1 c.47.1.3 (3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
gldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilelaa
qvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflldv
ledp

SCOP Domain Coordinates for d1a8y_1:

Click to download the PDB-style file with coordinates for d1a8y_1.
(The format of our PDB-style files is described here.)

Timeline for d1a8y_1: