SCOP 1.57: Domain d1a8y_3: 1a8y 229-347

Lineage for d1a8y_3 (1a8y 229-347)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.3: Calsequestrin [52855] (1 protein)

6. Protein Calsequestrin [52856] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry)

8. Domain d1a8y_3: 1a8y 229-347 [32783]

Details for d1a8y_3

PDB Entry: 1a8y, 2.4 Å

PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution

SCOP Domain Sequences for d1a8y_3:

Sequence, based on SEQRES records:

>d1a8y_3 c.47.1.3 (229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
tlrklkpesmyetweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwid
pddfpllvpywektfdidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvl

Sequence, based on observed residues (ATOM records):

>d1a8y_3 c.47.1.3 (229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
tlrklkpesmyetweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwid
pddfpllvpywektfdidlsapqigvvnvtdadsvwmepsaeeledwledvl

Timeline for d1a8y_3:

• d1a8y_3 first appeared (with stable ids) in SCOP 1.55
  
• d1a8y_3 appears in SCOP 1.59
  
• d1a8y_3 appears in the current release, SCOPe 2.08, called d1a8ya3