Lineage for d1a8y_2 (1a8y 127-228)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.3: Calsequestrin [52855] (1 protein) Protein Calsequestrin [52856] (1 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry) 
Domain d1a8y_2: 1a8y 127-228 [32782]
Details for d1a8y_2
PDB Entry: 1a8y (more details), 2.4 Å
PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution
SCOP Domain Sequences for d1a8y_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8y_2 c.47.1.3 (127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
veliegerelqafeniedeikligyfknkdsehykafkeaaeefhpyipffatfdskvak
kltlklneidfyeafmeepvtipdkpnseeeivnfveehrrs
SCOP Domain Coordinates for d1a8y_2:
Click to download the PDB-style file with coordinates for d1a8y_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8y_2:
- d1a8y_2 first appeared (with stable ids) in SCOP 1.55
- d1a8y_2 appears in SCOP 1.59
- d1a8y_2 appears in the current release, SCOPe 2.08, called d1a8ya2
View in 3D
