Lineage for d5kx5b1 (5kx5 B:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472270Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries)
  8. 2472311Domain d5kx5b1: 5kx5 B:1-245 [327672]
    Other proteins in same PDB: d5kx5b2, d5kx5c2, d5kx5d2, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
    automated match to d4drxb1
    complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5b1

PDB Entry: 5kx5 (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5kx5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kx5b1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5kx5b1:

Click to download the PDB-style file with coordinates for d5kx5b1.
(The format of our PDB-style files is described here.)

Timeline for d5kx5b1: