Lineage for d5tc4a2 (5tc4 A:157-332)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455436Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries)
  8. 2455505Domain d5tc4a2: 5tc4 A:157-332 [327232]
    Other proteins in same PDB: d5tc4a1
    automated match to d4a5od2
    complexed with l34, nad, po4

Details for d5tc4a2

PDB Entry: 5tc4 (more details), 1.89 Å

PDB Description: crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d5tc4a2:

Sequence, based on SEQRES records: (download)

>d5tc4a2 c.2.1.0 (A:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl

Sequence, based on observed residues (ATOM records): (download)

>d5tc4a2 c.2.1.0 (A:157-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhkpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl

SCOPe Domain Coordinates for d5tc4a2:

Click to download the PDB-style file with coordinates for d5tc4a2.
(The format of our PDB-style files is described here.)

Timeline for d5tc4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc4a1