SCOPe 2.07: Domain d5tc4a1: 5tc4 A:36-156

Lineage for d5tc4a1 (5tc4 A:36-156)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225016] (9 PDB entries)

8. Domain d5tc4a1: 5tc4 A:36-156 [327231]
   Other proteins in same PDB: d5tc4a2
   automated match to d4a5oa1
   complexed with l34, nad, po4

Details for d5tc4a1

PDB Entry: 5tc4, 1.89 Å

PDB Description: crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors

PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d5tc4a1:

Sequence; same for both SEQRES and ATOM records:

>d5tc4a1 c.58.1.0 (A:36-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaavv
ginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdvd
g

Timeline for d5tc4a1:

• d5tc4a1 first appeared in SCOPe 2.06
  
• d5tc4a1 appears in the current release, SCOPe 2.08