Lineage for d1tho__ (1tho -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395895Species Escherichia coli [TaxId:562] [52836] (11 PDB entries)
  8. 395901Domain d1tho__: 1tho - [32722]
    complexed with cu; mutant

Details for d1tho__

PDB Entry: 1tho (more details), 2.3 Å

PDB Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site

SCOP Domain Sequences for d1tho__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tho__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d1tho__:

Click to download the PDB-style file with coordinates for d1tho__.
(The format of our PDB-style files is described here.)

Timeline for d1tho__: