PDB entry 1tho

View 1tho on RCSB PDB site
Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site
Deposited on 1993-01-28, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1tho__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tho_ (-)
  sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
  idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla