SCOP 1.69: Domain d1tho__: 1tho -

Lineage for d1tho__ (1tho -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.1: Thioltransferase [52834] (11 proteins)

6. Protein Thioredoxin [52835] (10 species)

7. Species Escherichia coli [TaxId:562] [52836] (21 PDB entries)

8. Domain d1tho__: 1tho - [32722]

Details for d1tho__

PDB Entry: 1tho, 2.3 Å

PDB Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site

SCOP Domain Sequences for d1tho__:

Sequence; same for both SEQRES and ATOM records:

>d1tho__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1tho__:

• d1tho__ first appeared (with stable ids) in SCOP 1.55
  
• d1tho__ appears in SCOP 1.67
  
• d1tho__ appears in SCOP 1.71
  
• d1tho__ appears in the current release, SCOPe 2.08, called d1thoa_