![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein Sulfurtransferase [52830] (2 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) |
![]() | Domain d1e0ca1: 1e0c A:1-135 [32717] complexed with edo, mg, so4 |
PDB Entry: 1e0c (more details), 1.8 Å
SCOPe Domain Sequences for d1e0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw laedrplsrelpapa
Timeline for d1e0ca1: