Lineage for d1e0ca1 (1e0c A:1-135)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24082Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
  4. 24083Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) (S)
  5. 24094Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins)
  6. 24111Protein Sulfurtransferase [52830] (1 species)
  7. 24112Species Azotobacter vinelandii [TaxId:354] [52831] (1 PDB entry)
  8. 24113Domain d1e0ca1: 1e0c A:1-135 [32717]

Details for d1e0ca1

PDB Entry: 1e0c (more details), 1.8 Å

PDB Description: sulfurtransferase from azotobacter vinelandii

SCOP Domain Sequences for d1e0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii}
mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
laedrplsrelpapa

SCOP Domain Coordinates for d1e0ca1:

Click to download the PDB-style file with coordinates for d1e0ca1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e0ca2