PDB entry 1e0c

View 1e0c on RCSB PDB site
Description: sulfurtransferase from azotobacter vinelandii
Class: sulfurtransferase
Keywords: sulfurtransferase, sulfur metabolism, thiosulfate:cyanide sulfurtransferase
Deposited on 2000-03-23, released 2000-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfurtransferase
    Species: AZOTOBACTER VINELANDII, synthetic [TaxId:354]
    Gene: RHDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0ca1, d1e0ca2
  • Heterogens: SO4, EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0cA (A:)
    mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
    glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
    laedrplsrelpapaggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvl
    aakgghipgavnfewtaamdpsralrirtdiagrleelgitpdkeivthcqthhrsglty
    liakalgyprvkgyagswgewgnhpdtpvel