SCOPe 2.07: Domain d5kkba_: 5kkb A:

Lineage for d5kkba_ (5kkb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family)
   automatically mapped to Pfam PF01532

5. Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)

6. Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101367] (2 PDB entries)

8. Domain d5kkba_: 5kkb A: [326966]
   automated match to d1nxca_
   complexed with 1ps, bma, bu1, la, man, nag

Details for d5kkba_

PDB Entry: 5kkb, 1.77 Å

PDB Description: structure of mouse golgi alpha-1,2-mannosidase ia and man9glcnac2-pa complex

PDB Compounds: (A:) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

SCOPe Domain Sequences for d5kkba_:

Sequence; same for both SEQRES and ATOM records:

>d5kkba_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
vdflppvgvenrepadatirekrakikemmthawnnykryawglnelkpiskeghssslf
gnikgativdaldtlfimgmktefqeakswikkyldfnvnaevsvfevnirfvggllsay
ylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasggssilaefgtl
hlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglgd
sfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmgh
ltcfaggmfalgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveai
atrqnekyyilrpevietymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyi
aresyddvqqsfflaetlkylylifsdddllplehwifnteahpfpilr

Timeline for d5kkba_:

• d5kkba_ first appeared in SCOPe 2.06
  
• d5kkba_ appears in the current release, SCOPe 2.08