Lineage for d5kkba_ (5kkb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722400Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2722401Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2722402Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2722425Species Mouse (Mus musculus) [TaxId:10090] [101367] (2 PDB entries)
  8. 2722427Domain d5kkba_: 5kkb A: [326966]
    automated match to d1nxca_
    complexed with 1ps, bu1, la, nag

Details for d5kkba_

PDB Entry: 5kkb (more details), 1.77 Å

PDB Description: structure of mouse golgi alpha-1,2-mannosidase ia and man9glcnac2-pa complex
PDB Compounds: (A:) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

SCOPe Domain Sequences for d5kkba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkba_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
vdflppvgvenrepadatirekrakikemmthawnnykryawglnelkpiskeghssslf
gnikgativdaldtlfimgmktefqeakswikkyldfnvnaevsvfevnirfvggllsay
ylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasggssilaefgtl
hlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglgd
sfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmgh
ltcfaggmfalgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveai
atrqnekyyilrpevietymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyi
aresyddvqqsfflaetlkylylifsdddllplehwifnteahpfpilr

SCOPe Domain Coordinates for d5kkba_:

Click to download the PDB-style file with coordinates for d5kkba_.
(The format of our PDB-style files is described here.)

Timeline for d5kkba_: