SCOP 1.67: Domain d1larb1: 1lar B:1340-1623

Lineage for d1larb1 (1lar B:1340-1623)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein RPTP Lar [52815] (1 species)
   duplication: tandem repeat of the phosphatase domain

7. Species Human (Homo sapiens) [TaxId:9606] [52816] (1 PDB entry)

8. Domain d1larb1: 1lar B:1340-1623 [32695]

Details for d1larb1

PDB Entry: 1lar, 2 Å

PDB Description: crystal structure of the tandem phosphatase domains of rptp lar

SCOP Domain Sequences for d1larb1:

Sequence; same for both SEQRES and ATOM records:

>d1larb1 c.45.1.2 (B:1340-1623) RPTP Lar {Human (Homo sapiens)}
twensnlevnkpknryanviaydhsrviltsidgvpgsdyinanyidgyrkqnayiatqg
plpetmgdfwrmvweqrtatvvmmtrleeksrvkcdqywpargtetcgliqvtlldtvel
atytvrtfalhksgssekrelrqfqfmawpdhgvpeyptpilaflrrvkacnpldagpmv
vhcsagvgrtgcfividamlermkhektvdiyghvtcmrsqrnymvqtedqyvfiheall
eaatcghtevparnlyahiqklgqvppgesvtamelefkllass

Timeline for d1larb1:

• d1larb1 first appeared (with stable ids) in SCOP 1.55
  
• d1larb1 appears in SCOP 1.65
  
• d1larb1 appears in SCOP 1.69
  
• d1larb1 appears in the current release, SCOPe 2.08