PDB entry 1lar

View 1lar on RCSB PDB site
Description: crystal structure of the tandem phosphatase domains of rptp lar
Deposited on 1999-04-20, released 2000-04-25
The last revision prior to the SCOP 1.67 freeze date was dated 2000-04-25, with a file datestamp of 2000-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1larA (A:)
    mitdladnierlkandglkfsqeyesidpgqqftwensnlevnkpknryanviaydhsrv
    iltsidgvpgsdyinanyidgyrkqnayiatqgplpetmgdfwrmvweqrtatvvmmtrl
    eeksrvkcdqywpargtetcgliqvtlldtvelatytvrtfalhksgssekrelrqfqfm
    awpdhgvpeyptpilaflrrvkacnpldagpmvvhcsagvgrtgcfividamlermkhek
    tvdiyghvtcmrsqrnymvqtedqyvfihealleaatcghtevparnlyahiqklgqvpp
    gesvtamelefkllasskahtsrfisanlpcnkfknrlvnimpyeltrvclqpirgvegs
    dyinasfldgyrqqkayiatqgplaestedfwrmlwehnstiivmltklremgrekchqy
    wpaersaryqyfvvdpmaeynmpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktg
    egfidfigqvhktkeqfgqdgpitvhcsagvgrtgvfitlsivlermryegvvdmfqtvk
    tlrtqrpamvqtedqyqlcyraaleylgsfdhyat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1larA (A:)
    mitdladnierlkandglkfsqeyesidpgqqftwensnlevnkpknryanviaydhsrv
    iltsidgvpgsdyinanyidgyrkqnayiatqgplpetmgdfwrmvweqrtatvvmmtrl
    eeksrvkcdqywpargtetcgliqvtlldtvelatytvrtfalhksgssekrelrqfqfm
    awpdhgvpeyptpilaflrrvkacnpldagpmvvhcsagvgrtgcfividamlermkhek
    tvdiyghvtcmrsqrnymvqtedqyvfihealleaatcghtevparnlyahiqklgqvpp
    gesvtamelefkllasssrfisanlpcnkfknrlvnimpyeltrvclqpirgvegsdyin
    asfldgyrqqkayiatqgplaestedfwrmlwehnstiivmltklremgrekchqywpae
    rsaryqyfvvdpmaeynmpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfi
    dfigqvhktkeqfgqdgpitvhcsagvgrtgvfitlsivlermryegvvdmfqtvktlrt
    qrpamvqtedqyqlcyraaleylgsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1larB (B:)
    mitdladnierlkandglkfsqeyesidpgqqftwensnlevnkpknryanviaydhsrv
    iltsidgvpgsdyinanyidgyrkqnayiatqgplpetmgdfwrmvweqrtatvvmmtrl
    eeksrvkcdqywpargtetcgliqvtlldtvelatytvrtfalhksgssekrelrqfqfm
    awpdhgvpeyptpilaflrrvkacnpldagpmvvhcsagvgrtgcfividamlermkhek
    tvdiyghvtcmrsqrnymvqtedqyvfihealleaatcghtevparnlyahiqklgqvpp
    gesvtamelefkllasskahtsrfisanlpcnkfknrlvnimpyeltrvclqpirgvegs
    dyinasfldgyrqqkayiatqgplaestedfwrmlwehnstiivmltklremgrekchqy
    wpaersaryqyfvvdpmaeynmpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktg
    egfidfigqvhktkeqfgqdgpitvhcsagvgrtgvfitlsivlermryegvvdmfqtvk
    tlrtqrpamvqtedqyqlcyraaleylgsfdhyat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1larB (B:)
    twensnlevnkpknryanviaydhsrviltsidgvpgsdyinanyidgyrkqnayiatqg
    plpetmgdfwrmvweqrtatvvmmtrleeksrvkcdqywpargtetcgliqvtlldtvel
    atytvrtfalhksgssekrelrqfqfmawpdhgvpeyptpilaflrrvkacnpldagpmv
    vhcsagvgrtgcfividamlermkhektvdiyghvtcmrsqrnymvqtedqyvfiheall
    eaatcghtevparnlyahiqklgqvppgesvtamelefkllasssrfisanlpcnkfknr
    lvnimpyeltrvclqpirgvegsdyinasfldgyrqqkayiatqgplaestedfwrmlwe
    hnstiivmltklremgrekchqywpaersaryqyfvvdpmaeynmpqyilrefkvtdard
    gqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdgpitvhcsagvgrtgvf
    itlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyraaleylgsf