Lineage for d1larb2 (1lar B:1628-1876)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395648Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 395664Protein RPTP Lar [52815] (1 species)
    duplication: tandem repeat of the phosphatase domain
  7. 395665Species Human (Homo sapiens) [TaxId:9606] [52816] (1 PDB entry)
  8. 395669Domain d1larb2: 1lar B:1628-1876 [32696]
    mutant

Details for d1larb2

PDB Entry: 1lar (more details), 2 Å

PDB Description: crystal structure of the tandem phosphatase domains of rptp lar

SCOP Domain Sequences for d1larb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1larb2 c.45.1.2 (B:1628-1876) RPTP Lar {Human (Homo sapiens)}
srfisanlpcnkfknrlvnimpyeltrvclqpirgvegsdyinasfldgyrqqkayiatq
gplaestedfwrmlwehnstiivmltklremgrekchqywpaersaryqyfvvdpmaeyn
mpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdg
pitvhcsagvgrtgvfitlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyr
aaleylgsf

SCOP Domain Coordinates for d1larb2:

Click to download the PDB-style file with coordinates for d1larb2.
(The format of our PDB-style files is described here.)

Timeline for d1larb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1larb1