Lineage for d1ytna_ (1ytn A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)
  7. Species Yersinia enterocolitica [TaxId:630] [52812] (20 PDB entries)
  8. Domain d1ytna_: 1ytn A: [32688]
    complexed with no3

Details for d1ytna_

PDB Entry: 1ytn (more details), 2.4 Å

PDB Description: hydrolase
PDB Compounds: (A:) yersinia protein tyrosine phosphatase

SCOPe Domain Sequences for d1ytna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytna_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d1ytna_ are not available.

Timeline for d1ytna_: