PDB entry 1ytn

View 1ytn on RCSB PDB site
Description: hydrolase
Class: hydrolase
Keywords: protein tyrosine phosphatase, hydrolase
Deposited on 1996-05-01, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yersinia protein tyrosine phosphatase
    Species: YERSINIA ENTEROCOLITICA [TaxId:630]
    Gene: YOP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered (72)
    Domains in SCOPe 2.08: d1ytna_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytnA (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytnA (A:)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
    qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns