Lineage for d5gljc1 (5glj C:1086-1178)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395625Protein Phosphatase hPTP1e [50168] (2 species)
  7. 2395626Species Human (Homo sapiens) [TaxId:9606] [50169] (8 PDB entries)
  8. 2395630Domain d5gljc1: 5glj C:1086-1178 [326431]
    Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
    automated match to d2h3lb_
    complexed with cl

Details for d5gljc1

PDB Entry: 5glj (more details), 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas
PDB Compounds: (C:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5gljc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gljc1 b.36.1.1 (C:1086-1178) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

SCOPe Domain Coordinates for d5gljc1:

Click to download the PDB-style file with coordinates for d5gljc1.
(The format of our PDB-style files is described here.)

Timeline for d5gljc1: