SCOPe 2.07: Domain d5glja1: 5glj A:1086-1178

Lineage for d5glja1 (5glj A:1086-1178)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
Superfamily b.36.1: PDZ domain-like [50156] (7 families)
peptide-binding domain
Family b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Phosphatase hPTP1e [50168] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [50169] (8 PDB entries)
Domain d5glja1: 5glj A:1086-1178 [326415]
Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
automated match to d2h3lb_
complexed with cl

Details for d5glja1

PDB Entry: 5glj (more details), 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5glja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5glja1 b.36.1.1 (A:1086-1178) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

SCOPe Domain Coordinates for d5glja1:

Click to download the PDB-style file with coordinates for d5glja1.
(The format of our PDB-style files is described here.)

Timeline for d5glja1: